FOXO4
<
>
FOXO4
FOXO4

Product Description

OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Appearance: Powder

Purity: >99% (or refer to the Certificate of Analysis)

Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

Solubility: To be determined

Shelf Life: >2 years if stored properly

icon png
“Strength builds the foundation, and excellent services reach all over the world.”

create win-win situation with customers

We have cooperated with experienced shipping forwarders for many years, they arrange the shipment. No matter by express, by air or by sea, we will track the course of the goods all the way, to make sure goods arrive at you on time and in good condition.

GET A QUOTE

Related Products

KPV

KPV

[Molecular formula] C16H30N4O4 [Molecular weight] 342.43 [Appearance] White powder [Purity] 99% [Function] 1. Accelerate wound healing and reduce infection; 2. Anti-inflammatory effect; 3. Antibacterial effect on pathogens; 4. Anti-tumor eff ...

NAD

NAD

NAD, also known as nicotinamide adenine dinucleotide, is an essential bioactive molecule in our body. Its main functions include: 1. NAD has significant anti-aging effects. As we age, the level of NAD in the human body gradually decreases, leading to accelera ...

Semaglutide

Semaglutide

lt is a dual glucose-dependent insulinotropic polypeptide (GIPand glucagon-like peptide-1 (GLP-1) receptor agonist that is beingdeveloped for the treatment of type 2 diabetes. lt shows significantlybetter  efficacy with regard to glucose control. ...

Retatrutide

Retatrutide

Sequence: Tyr-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{α-Me-Leu}-Leu-Asp-Lys-{doacod=C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-{Aib}-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Molecular Formula: C118H175N35O28 M ...

BPC 157

BPC 157

Common Name BPC 157 Density 1.4±0.1 g/cm3 Boiling Point 1802.9±65.0 °C at 760 mmHg ...

Tirz

Tirz

lt is a dual glucose-dependent insulinotropic polypeptide (GIPand glucagon-like peptide-1 (GLP-1) receptor agonist that is beingdeveloped for the treatment of type 2 diabetes. lt shows significantlybetter  efficacy with regard to glucose control. ...

Cagrilintide

Cagrilintide

Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids and a pair of disulfide bonds. Kaglirin can significantly reduce weight and reduce food intake. Kagrelin peptide has potential in obesity research. As a n ...

Lipo-C

Lipo-C

10 mL vial Amount per mL: Methionine 25mg Inositol 50mg Choline 50mg B6 (Pyridoxine) 25mg B5 (Dexpanthenol) 25mg B12 (Methylcobalamin)1mg  L-Carnitine 20mg L-Arginine 20mg 2% Benzyl Alcohol 2% Lidocaine  0.1% In sterile water ...

GHK-CU

GHK-CU

GHK-CU Certificate ...

Tesamorelin 10mg

Tesamorelin 10mg

Tesamorelin, is a syntheitic peptide consiting of 44 amino acids. It is a growth-hormone-releasing hormone (GHRH) analogue researched for the treatment of HIV-associated lipodystrophy (dysfunctional, toxic fat deposition). It is also being researched for i ...

TB 500

TB 500

1. TB500 fragment has been shown to have the ability to promote the formation of blood vessels and to help repair damaged tissues. It also has anti-inflammatory properties and may help to reduce swelling and pain. Additionally, TB500 fragment has been found to ...

PT 141

PT 141

PT 141, also known as Bremelanotide, is a synthetic peptide developed for its unique properties related to sexual health and arousal. Originally derived from the peptide hormone Melanotan II, PT 141 is specifically designed to enhance libido in both men an ...

AOD9604

AOD9604

AOD 9604, also known as Anti-Obesity Drug 9604, is a synthetic peptide fragment derived from human growth hormone (HGH). Specifically, it consists of amino acids 176-191 of the C-terminus of the HGH molecule. This peptide has been extensively studied for its p ...