Products -HK XRD Peptide

Products

hyaluronic acid peptide

Items Specifications Product Name Hyaluronic Acid Powder Cas No 9004-61-9 Einecs 232-678-0 MF C14H22NNaO11 MW 403.31 Melting Point >209°C (dec.) Appearance White powder Shelf Life 2 Years When Properly Stored Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder. ...

Snap-8

Product Name: Snap-8 Purity: >98% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly Drug Formulation: To be determined Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months). ...

FOXO4

OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly ...

NAD+

Product name NAD+ CAS number 53-84-9 Purity ≥99% Appearance White Powder Application Longevity supplements Molecular Formula C21H27N7O14P2 Molecular Weight 663.43g/mol Reconstitution Required Storage After reconstitution store at 2°C - 8°C ...

Glow BPC 157 10mg+GHK-CU 50mg+TB500 10mg

BPC 157 10mg GHK-CU 50mg TB500 10mg Certificate ...

Follistatin

Follistatin is studied for its role in regulation of muscle growth in mice, also known as GDF-8, a TGF super family member which inhibits excessive muscle growth ...

IGF-1LR3

Items Specifications Product Name IGF-1LR3 Other Names CL281;LR3-IGF1;IDF-1 LR3;IGF LR3-1;IGF-1 LR3;IGF-1Lr3 Igtropin;LR3-IGF1 (100mcg/vial;Recombinant Human Insulin-like Growth Factor-1 LR3, rhIGF-1 CAS 946870-92-4 Molecular Formula C50H69N15O9 Appearance White power CBNumber CB6947862 Storage Dry, dark and at 0 - 4 C for short term or -20 C for long term Purity ≥99% Certificate ...

LL37

The LL-37 precursor consists of a signal peptide, cathelin conserved region, and 37 amino acid residues that, when activated, are cleaved by serine protease 3 and other proteolytic enzymes to produce bioactive LL-37, which has antibacterial, antifungal, and antiviral functions, as well as chemotactic and immunostimulatory/regulatory effects. ...

Epithalon

Density 1.5±0.1 g/cm3 Boiling Point 959.8±65.0 °C at 760 mmHg Molecular Formula C14H22N4O9 Molecular Weight 390.346 Flash Point 534.3±34.3 °C Exact Mass 390.138672 LogP -2.02 Vapour Pressure 0.0±0.6 mmHg at 25°C Index of Refraction 1.559 Certificate ...